EGF (Human) Recombinant Protein
  • EGF (Human) Recombinant Protein

EGF (Human) Recombinant Protein

Ref: AB-P7534
EGF (Human) Recombinant Protein

Información del producto

Human EGF (P01133, 971 a.a. - 1023 a.a.) partial recombinant protein with His tag at C-teminus expressed with an N terminal Met in Escherichia coli.
Información adicional
Size 10 ug
Gene Name EGF
Gene Alias HOMG4|URG
Gene Description epidermal growth factor (beta-urogastrone)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 1950

Enviar uma mensagem


EGF (Human) Recombinant Protein

EGF (Human) Recombinant Protein