Tnfsf10 (Mouse) Recombinant Protein
  • Tnfsf10 (Mouse) Recombinant Protein

Tnfsf10 (Mouse) Recombinant Protein

Ref: AB-P7533
Tnfsf10 (Mouse) Recombinant Protein

Información del producto

Mouse Tnfsf10 (P50592, 119 a.a. - 291 a.a.) partial recombinant protein expressed with an N-terminal Gly in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Tnfsf10
Gene Alias A330042I21Rik|AI448571|APO-2L|Ly81|TL2|Trail
Gene Description tumor necrosis factor (ligand) superfamily, member 10
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 22035

Enviar uma mensagem


Tnfsf10 (Mouse) Recombinant Protein

Tnfsf10 (Mouse) Recombinant Protein