ANXA5 (Human) Recombinant Protein
  • ANXA5 (Human) Recombinant Protein

ANXA5 (Human) Recombinant Protein

Ref: AB-P7530
ANXA5 (Human) Recombinant Protein

Información del producto

Human ANXA5 (P08758, 1 a.a. - 320 a.a.) partial recombinant protein with His tag at C-terminus expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name ANXA5
Gene Alias ANX5|ENX2|PP4
Gene Description annexin A5
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETL
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 308

Enviar uma mensagem


ANXA5 (Human) Recombinant Protein

ANXA5 (Human) Recombinant Protein