CTSB (Human) Recombinant Protein
  • CTSB (Human) Recombinant Protein

CTSB (Human) Recombinant Protein

Ref: AB-P7514
CTSB (Human) Recombinant Protein

Información del producto

Human CTSB (P07858, 18 a.a. - 339 a.a.) partial recombinant protein with His tag at C-teminus expressed in CHO cell.
Información adicional
Size 10 ug
Gene Name CTSB
Gene Alias APPS|CPSB
Gene Description cathepsin B
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTG
Form Liquid
Storage Buffer In 25 mM Tris-HCl buffer, 150 mM NaCl, pH 8.0 (20% glycerol)
Gene ID 1508

Enviar uma mensagem


CTSB (Human) Recombinant Protein

CTSB (Human) Recombinant Protein