NGR1 (Human) Recombinant Protein View larger

Human NRG1 (Q02297-6, 176 a.a. - 246 a.a.) partial recombinant protein expressed in CHO cell.

AB-P7513

New product

NGR1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.


Data sheet

Size 10 ug
Gene Name NRG1
Gene Alias ARIA|GGF|GGF2|HGL|HRG|HRG1|HRGA|NDF|SMDF
Gene Description neuregulin 1
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 3084

More info

Human NRG1 (Q02297-6, 176 a.a. - 246 a.a.) partial recombinant protein expressed in CHO cell.

Enviar uma mensagem

Human NRG1 (Q02297-6, 176 a.a. - 246 a.a.) partial recombinant protein expressed in CHO cell.

Human NRG1 (Q02297-6, 176 a.a. - 246 a.a.) partial recombinant protein expressed in CHO cell.