IL15 (Human) Recombinant Protein
  • IL15 (Human) Recombinant Protein

IL15 (Human) Recombinant Protein

Ref: AB-P7503
IL15 (Human) Recombinant Protein

Información del producto

Human IL15 (P40933, 49 a.a. - 162 a.a.) partial recombinant protein with His tag expressed at N-terminus in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL15
Gene Alias IL-15|MGC9721
Gene Description interleukin 15
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 3600

Enviar uma mensagem


IL15 (Human) Recombinant Protein

IL15 (Human) Recombinant Protein