Csf2 (Mouse) Recombinant Protein
  • Csf2 (Mouse) Recombinant Protein

Csf2 (Mouse) Recombinant Protein

Ref: AB-P7495
Csf2 (Mouse) Recombinant Protein

Información del producto

Mouse Csf2 (Q14AD9, 18 a.a. - 141 a.a.) partial recombinant protein expressed at N-terminus in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Csf2
Gene Alias Csfgm|Gm-CSf|MGC151255|MGC151257|MGI-IGM
Gene Description colony stimulating factor 2 (granulocyte-macrophage)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 12981

Enviar uma mensagem


Csf2 (Mouse) Recombinant Protein

Csf2 (Mouse) Recombinant Protein