Fgf21 (Mouse) Recombinant Protein
  • Fgf21 (Mouse) Recombinant Protein

Fgf21 (Mouse) Recombinant Protein

Ref: AB-P7489
Fgf21 (Mouse) Recombinant Protein

Información del producto

Mouse Fgf21 (Q9JJN1, 29 a.a. - 210 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Fgf21
Gene Alias -
Gene Description fibroblast growth factor 21
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -81C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 56636

Enviar uma mensagem


Fgf21 (Mouse) Recombinant Protein

Fgf21 (Mouse) Recombinant Protein