FGF16 (Human) Recombinant Protein
  • FGF16 (Human) Recombinant Protein

FGF16 (Human) Recombinant Protein

Ref: AB-P7487
FGF16 (Human) Recombinant Protein

Información del producto

Human FGF16 (O43320, 2 a.a. - 207 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name FGF16
Gene Alias -
Gene Description fibroblast growth factor 16
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, 5mM EDTA, pH 7.5. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 8823

Enviar uma mensagem


FGF16 (Human) Recombinant Protein

FGF16 (Human) Recombinant Protein