Ctf1 (Mouse) Recombinant Protein
  • Ctf1 (Mouse) Recombinant Protein

Ctf1 (Mouse) Recombinant Protein

Ref: AB-P7486
Ctf1 (Mouse) Recombinant Protein

Información del producto

Mouse Ctf1 (Q60753-1, 2 a.a. - 203 a.a.) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 10 ug
Gene Name Ctf1
Gene Alias CT-1
Gene Description cardiotrophin 1
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 13019

Enviar uma mensagem


Ctf1 (Mouse) Recombinant Protein

Ctf1 (Mouse) Recombinant Protein