View larger
Mouse Ccl2 (Q5SVU3, 24 a.a. - 96 a.a.) partial recombinant protein expressed in HEK293 cells.
AB-P7483
New product
Ccl2 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | Ccl2 |
| Gene Alias | AI323594|HC11|JE|MCAF|MCP-1|MCP1|SMC-CF|Scya2|Sigje |
| Gene Description | chemokine (C-C motif) ligand 2 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O or PBS up to 100 ug/mL. |
| Gene ID | 20296 |
More info
Mouse Ccl2 (Q5SVU3, 24 a.a. - 96 a.a.) partial recombinant protein expressed in HEK293 cells.