BTC (Human) Recombinant Protein
  • BTC (Human) Recombinant Protein

BTC (Human) Recombinant Protein

Ref: AB-P7462
BTC (Human) Recombinant Protein

Información del producto

Human BTC (P35070, 32 a.a. - 111 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name BTC
Gene Alias -
Gene Description betacellulin
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 685

Enviar uma mensagem


BTC (Human) Recombinant Protein

BTC (Human) Recombinant Protein