IL22 (Human) Recombinant Protein
  • IL22 (Human) Recombinant Protein

IL22 (Human) Recombinant Protein

Ref: AB-P7461
IL22 (Human) Recombinant Protein

Información del producto

Human IL22 (Q9GZX6, 34 a.a. - 179 a.a.) partial recombinant protein expressed with an N-terminal Met in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL22
Gene Alias IL-21|IL-22|IL-D110|IL-TIF|IL21|ILTIF|MGC79382|MGC79384|TIFIL-23|TIFa|zcyto18
Gene Description interleukin 22
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 50616

Enviar uma mensagem


IL22 (Human) Recombinant Protein

IL22 (Human) Recombinant Protein