Flt3l (Mouse) Recombinant Protein View larger

Mouse Flt3l (P49772, 27 a.a. - 188 a.a.) partial recombinant protein with His tag expressed in CHO cells.

AB-P7453

New product

Flt3l (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 10 ug
Gene Name Flt3l
Gene Alias Flt3lg|Ly72L
Gene Description FMS-like tyrosine kinase 3 ligand
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O or PBS up to 100 ug/mL.
Gene ID 14256

More info

Mouse Flt3l (P49772, 27 a.a. - 188 a.a.) partial recombinant protein with His tag expressed in CHO cells.

Enviar uma mensagem

Mouse Flt3l (P49772, 27 a.a. - 188 a.a.) partial recombinant protein with His tag expressed in CHO cells.

Mouse Flt3l (P49772, 27 a.a. - 188 a.a.) partial recombinant protein with His tag expressed in CHO cells.