Il12a and Il12b (Rat) Recombinant Protein
  • Il12a and Il12b (Rat) Recombinant Protein

Il12a and Il12b (Rat) Recombinant Protein

Ref: AB-P7446
Il12a and Il12b (Rat) Recombinant Protein

Información del producto

Rat Il12a (Q9R103, 23 a.a. - 215 a.a.) partial recombinant protein with His tag and Il12b (E9PU71, 23 a.a. - 335 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name Il12a
Gene Alias -
Gene Description interleukin 12a
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSS MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFL
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 84405|64546

Enviar uma mensagem


Il12a and Il12b (Rat) Recombinant Protein

Il12a and Il12b (Rat) Recombinant Protein