NIl7 (Mouse) Recombinant Protein
  • NIl7 (Mouse) Recombinant Protein

NIl7 (Mouse) Recombinant Protein

Ref: AB-P7445
NIl7 (Mouse) Recombinant Protein

Información del producto

Mouse Il7 (Q544C8, 26 a.a. - 154 a.a.) partial recombinant protein with His tag expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name Il7
Gene Alias A630026I06Rik|Il-7|MGC129342|hlb368
Gene Description interleukin 7
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 16196

Enviar uma mensagem


NIl7 (Mouse) Recombinant Protein

NIl7 (Mouse) Recombinant Protein