IL33 (Human) Recombinant Protein
  • IL33 (Human) Recombinant Protein

IL33 (Human) Recombinant Protein

Ref: AB-P7436
IL33 (Human) Recombinant Protein

Información del producto

Human IL33 (O95760, 112 a.a. - 270 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL33
Gene Alias C9orf26|DKFZp586H0523|DVS27|NF-HEV|NFEHEV|RP11-575C20.2
Gene Description interleukin 33
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 90865

Enviar uma mensagem


IL33 (Human) Recombinant Protein

IL33 (Human) Recombinant Protein