Pdgfb (Rat) Recombinant Protein
  • Pdgfb (Rat) Recombinant Protein

Pdgfb (Rat) Recombinant Protein

Ref: AB-P7428
Pdgfb (Rat) Recombinant Protein

Información del producto

Rat Pdgfb (Q05028, 74 a.a. - 182 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Pdgfb
Gene Alias SIS|c-sis
Gene Description platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized after extensive dialysis against 20 mM acetic acid. Reconstitute the lyophilized powder in 20 mM acetic acid up to 100 ug/mL.
Gene ID 24628

Enviar uma mensagem


Pdgfb (Rat) Recombinant Protein

Pdgfb (Rat) Recombinant Protein