View larger
Mouse Igf1 (P05017, 49 a.a. - 118 a.a.) partial recombinant protein with an N-terminal Met expressed in <i>Escherichia coli</i>.
AB-P7427
New product
Igf1 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | Igf1 |
| Gene Alias | C730016P09Rik|Igf-1|Igf-I |
| Gene Description | insulin-like growth factor 1 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL. |
| Gene ID | 16000 |
More info
Mouse Igf1 (P05017, 49 a.a. - 118 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli.