IGF1 (Human) Recombinant Protein
  • IGF1 (Human) Recombinant Protein

IGF1 (Human) Recombinant Protein

Ref: AB-P7426
IGF1 (Human) Recombinant Protein

Información del producto

Human IGF1 (P05019, 53 a.a. - 118 a.a.) partial recombinant protein expressed with additional N-terminal sequence (MFPAMPLSSLFVNGPRT) expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name IGF1
Gene Alias IGFI
Gene Description insulin-like growth factor 1 (somatomedin C)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from a solution in 48% acetonitrile, 0.1% TFA. Reconstitute the lyophilized powder in 10 mM HCl up to 1mg/mL.
Gene ID 3479

Enviar uma mensagem


IGF1 (Human) Recombinant Protein

IGF1 (Human) Recombinant Protein