View larger
Human IGF1 (P05019, 53 a.a. - 118 a.a.) partial recombinant protein expressed with additional N-terminal sequence (MFPAMPLSSLFVN
AB-P7426
New product
IGF1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | IGF1 |
| Gene Alias | IGFI |
| Gene Description | insulin-like growth factor 1 (somatomedin C) |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | LCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCA |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from a solution in 48% acetonitrile, 0.1% TFA. Reconstitute the lyophilized powder in 10 mM HCl up to 1mg/mL. |
| Gene ID | 3479 |
More info
Human IGF1 (P05019, 53 a.a. - 118 a.a.) partial recombinant protein expressed with additional N-terminal sequence (MFPAMPLSSLFVNGPRT) expressed in Escherichia coli.