Thpo (Mouse) Recombinant Protein
  • Thpo (Mouse) Recombinant Protein

Thpo (Mouse) Recombinant Protein

Ref: AB-P7424
Thpo (Mouse) Recombinant Protein

Información del producto

Mouse Thpo (P40226, 22 a.a. - 356 a.a.) partial recombinant protein expressed in HEK 293 Cells.
Información adicional
Size 10 ug
Gene Name Thpo
Gene Alias Mpllg|TPO|TPO-1|TPO-2|TPO-3|TPO-4
Gene Description thrombopoietin
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGTSLQTLEASDIS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 21832

Enviar uma mensagem


Thpo (Mouse) Recombinant Protein

Thpo (Mouse) Recombinant Protein