FGF8 (Human) Recombinant Protein
  • FGF8 (Human) Recombinant Protein

FGF8 (Human) Recombinant Protein

Ref: AB-P7422
FGF8 (Human) Recombinant Protein

Información del producto

Human FGF8 (P55075, 23 a.a. - 204 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name FGF8
Gene Alias AIGF|HBGF-8|MGC149376
Gene Description fibroblast growth factor 8 (androgen-induced)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 2253

Enviar uma mensagem


FGF8 (Human) Recombinant Protein

FGF8 (Human) Recombinant Protein