IL4R (Human) Recombinant Protein
  • IL4R (Human) Recombinant Protein

IL4R (Human) Recombinant Protein

Ref: AB-P7408
IL4R (Human) Recombinant Protein

Información del producto

Human IL4R (P24394, 24 a.a. - 232 a.a.) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 10 ug
Gene Name IL4R
Gene Alias CD124|IL4RA
Gene Description interleukin 4 receptor
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 3566

Enviar uma mensagem


IL4R (Human) Recombinant Protein

IL4R (Human) Recombinant Protein