VEGFA (Human) Recombinant Protein
  • VEGFA (Human) Recombinant Protein

VEGFA (Human) Recombinant Protein

Ref: AB-P7401
VEGFA (Human) Recombinant Protein

Información del producto

Human VEGFA (P15692-9, 28 a.a. - 147 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name VEGFA
Gene Alias MGC70609|VEGF|VEGF-A|VPF
Gene Description vascular endothelial growth factor A
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq PMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGK
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL.
Gene ID 7422

Enviar uma mensagem


VEGFA (Human) Recombinant Protein

VEGFA (Human) Recombinant Protein