View larger
Human VEGFA (P15692-9, 28 a.a. - 147 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7401
New product
VEGFA (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | VEGFA |
| Gene Alias | MGC70609|VEGF|VEGF-A|VPF |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | PMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGK |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O or PBS up to 100 ug/mL. |
| Gene ID | 7422 |
More info
Human VEGFA (P15692-9, 28 a.a. - 147 a.a.) partial recombinant protein expressed in Escherichia coli.