CXCL5 (Human) Recombinant Protein
  • CXCL5 (Human) Recombinant Protein

CXCL5 (Human) Recombinant Protein

Ref: AB-P7396
CXCL5 (Human) Recombinant Protein

Información del producto

Human CXCL5 (P42830, 37 a.a. - 114 a.a.) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 5 ug
Gene Name CXCL5
Gene Alias ENA-78|SCYB5
Gene Description chemokine (C-X-C motif) ligand 5
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 6374

Enviar uma mensagem


CXCL5 (Human) Recombinant Protein

CXCL5 (Human) Recombinant Protein