CCL5 (Human) Recombinant Protein
  • CCL5 (Human) Recombinant Protein

CCL5 (Human) Recombinant Protein

Ref: AB-P7393
CCL5 (Human) Recombinant Protein

Información del producto

Human CCL5 (P13501, 24 a.a. - 91 a.a.) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 5 ug
Gene Name CCL5
Gene Alias D17S136E|MGC17164|RANTES|SCYA5|SISd|TCP228
Gene Description chemokine (C-C motif) ligand 5
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 6352

Enviar uma mensagem


CCL5 (Human) Recombinant Protein

CCL5 (Human) Recombinant Protein