NOG (Human) Recombinant Protein
  • NOG (Human) Recombinant Protein

NOG (Human) Recombinant Protein

Ref: AB-P7390
NOG (Human) Recombinant Protein

Información del producto

Human NOG (Q13253, 28 a.a. - 232 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name NOG
Gene Alias SYM1|SYNS1
Gene Description noggin
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 9241

Enviar uma mensagem


NOG (Human) Recombinant Protein

NOG (Human) Recombinant Protein