Nog (Mouse) Recombinant Protein
  • Nog (Mouse) Recombinant Protein

Nog (Mouse) Recombinant Protein

Ref: AB-P7389
Nog (Mouse) Recombinant Protein

Información del producto

Mouse Nog (P97466, 20 a.a. - 232 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 5 ug
Gene Name Nog
Gene Alias -
Gene Description noggin
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 18121

Enviar uma mensagem


Nog (Mouse) Recombinant Protein

Nog (Mouse) Recombinant Protein