Il13 (Mouse) Recombinant Protein
  • Il13 (Mouse) Recombinant Protein

Il13 (Mouse) Recombinant Protein

Ref: AB-P7388
Il13 (Mouse) Recombinant Protein

Información del producto

Mouse Il13 (P20109, 22 a.a. - 131 a.a.) partial recombinant protein with His tag expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name Il13
Gene Alias Il-13
Gene Description interleukin 13
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 16163

Enviar uma mensagem


Il13 (Mouse) Recombinant Protein

Il13 (Mouse) Recombinant Protein