IL7 (Human) Recombinant Protein
  • IL7 (Human) Recombinant Protein

IL7 (Human) Recombinant Protein

Ref: AB-P7387
IL7 (Human) Recombinant Protein

Información del producto

Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein with His tag expressed in CHO cells.
Información adicional
Size 25 ug
Gene Name IL7
Gene Alias IL-7
Gene Description interleukin 7
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNST
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 3574

Enviar uma mensagem


IL7 (Human) Recombinant Protein

IL7 (Human) Recombinant Protein