FGF7 (Human) Recombinant Protein
  • FGF7 (Human) Recombinant Protein

FGF7 (Human) Recombinant Protein

Ref: AB-P7386
FGF7 (Human) Recombinant Protein

Información del producto

Human FGF7 (P21781, 32 a.a. - 194 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 5 ug
Gene Name FGF7
Gene Alias HBGF-7|KGF
Gene Description fibroblast growth factor 7 (keratinocyte growth factor)
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 2252

Enviar uma mensagem


FGF7 (Human) Recombinant Protein

FGF7 (Human) Recombinant Protein