Il10 (Rat) Recombinant Protein
  • Il10 (Rat) Recombinant Protein

Il10 (Rat) Recombinant Protein

Ref: AB-P7385
Il10 (Rat) Recombinant Protein

Información del producto

Rat Il10 (P29456, 19 a.a. - 178 a.a.) partial recombinant Protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name Il10
Gene Alias IL10X
Gene Description interleukin 10
Storage Conditions Store at 4C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 25325

Enviar uma mensagem


Il10 (Rat) Recombinant Protein

Il10 (Rat) Recombinant Protein