IL6R (Human) Recombinant Protein
  • IL6R (Human) Recombinant Protein

IL6R (Human) Recombinant Protein

Ref: AB-P7378
IL6R (Human) Recombinant Protein

Información del producto

Human IL6R (P08887, 20 a.a. - 365 a.a ) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name IL6R
Gene Alias CD126|IL-6R-1|IL-6R-alpha|IL6RA|MGC104991
Gene Description interleukin 6 receptor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 3570

Enviar uma mensagem


IL6R (Human) Recombinant Protein

IL6R (Human) Recombinant Protein