TNFSF12 (Human) Recombinant Protein
  • TNFSF12 (Human) Recombinant Protein

TNFSF12 (Human) Recombinant Protein

Ref: AB-P7376
TNFSF12 (Human) Recombinant Protein

Información del producto

Human TNFSF12 (Q4ACW9, 99 a.a. - 249 a.a ) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name TNFSF12
Gene Alias APO3L|DR3LG|MGC129581|MGC20669|TWEAK
Gene Description tumor necrosis factor (ligand) superfamily, member 12
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 8742

Enviar uma mensagem


TNFSF12 (Human) Recombinant Protein

TNFSF12 (Human) Recombinant Protein