Il1a (Rat) Recombinant Protein
  • Il1a (Rat) Recombinant Protein

Il1a (Rat) Recombinant Protein

Ref: AB-P7370
Il1a (Rat) Recombinant Protein

Información del producto

Rat Il1a (P16598, 116 a.a. - 270 a.a.) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name Il1a
Gene Alias IL-1 alpha
Gene Description interleukin 1 alpha
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 24493

Enviar uma mensagem


Il1a (Rat) Recombinant Protein

Il1a (Rat) Recombinant Protein