TNFRSF1A (Human) Recombinant Protein
  • TNFRSF1A (Human) Recombinant Protein

TNFRSF1A (Human) Recombinant Protein

Ref: AB-P7363
TNFRSF1A (Human) Recombinant Protein

Información del producto

Human TNFRSF1A (P19438, 50 a.a. - 211 a.a ) partial recombinant protein expressed in CHO cells.
Información adicional
Size 10 ug
Gene Name TNFRSF1A
Gene Alias CD120a|FPF|MGC19588|TBP1|TNF-R|TNF-R-I|TNF-R55|TNFAR|TNFR1|TNFR55|TNFR60|p55|p55-R|p60
Gene Description tumor necrosis factor receptor superfamily, member 1A
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 7132

Enviar uma mensagem


TNFRSF1A (Human) Recombinant Protein

TNFRSF1A (Human) Recombinant Protein