Fgf18 (Rat) Recombinant Protein
  • Fgf18 (Rat) Recombinant Protein

Fgf18 (Rat) Recombinant Protein

Ref: AB-P7360
Fgf18 (Rat) Recombinant Protein

Información del producto

Rat Fgf18 (O88182, 28 a.a. - 199 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Fgf18
Gene Alias -
Gene Description fibroblast growth factor 18
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQTELQKPFKYTTVTKRSR
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 29369

Enviar uma mensagem


Fgf18 (Rat) Recombinant Protein

Fgf18 (Rat) Recombinant Protein