Tnfsf18 (Mouse) Recombinant Protein
  • Tnfsf18 (Mouse) Recombinant Protein

Tnfsf18 (Mouse) Recombinant Protein

Ref: AB-P7358
Tnfsf18 (Mouse) Recombinant Protein

Información del producto

Mouse Tnfsf18 (Q7TS55, 47 a.a. - 173 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Tnfsf18
Gene Alias Gitrl
Gene Description tumor necrosis factor (ligand) superfamily, member 18
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 240873

Enviar uma mensagem


Tnfsf18 (Mouse) Recombinant Protein

Tnfsf18 (Mouse) Recombinant Protein