Pdgfb (Mouse) Recombinant Protein
  • Pdgfb (Mouse) Recombinant Protein

Pdgfb (Mouse) Recombinant Protein

Ref: AB-P7356
Pdgfb (Mouse) Recombinant Protein

Información del producto

Mouse Pdgfb (P31240, 82 a.a. - 190 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Pdgfb
Gene Alias PDGF-B|Sis
Gene Description platelet derived growth factor, B polypeptide
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from 10 mM sodium citrate, pH 3.0. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 18591

Enviar uma mensagem


Pdgfb (Mouse) Recombinant Protein

Pdgfb (Mouse) Recombinant Protein