IL21 (Human) Recombinant Protein
  • IL21 (Human) Recombinant Protein

IL21 (Human) Recombinant Protein

Ref: AB-P7345
IL21 (Human) Recombinant Protein

Información del producto

Human IL21 (Q9HBE4, 25 a.a. - 155 a.a ) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL21
Gene Alias IL-21|Za11
Gene Description interleukin 21
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq HKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSR
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 59067

Enviar uma mensagem


IL21 (Human) Recombinant Protein

IL21 (Human) Recombinant Protein