ADIPOQ (Human) Recombinant Protein View larger

Human ADIPOQ (Q15848, 101 a.a. - 244 a.a ) partial recombinant protein expressed in HEK293 cells.

AB-P7342

New product

ADIPOQ (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.


Data sheet

Size 10 ug
Gene Name ADIPOQ
Gene Alias ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL.
Gene ID 9370

More info

Human ADIPOQ (Q15848, 101 a.a. - 244 a.a ) partial recombinant protein expressed in HEK293 cells.

Enviar uma mensagem

Human ADIPOQ (Q15848, 101 a.a. - 244 a.a ) partial recombinant protein expressed in HEK293 cells.

Human ADIPOQ (Q15848, 101 a.a. - 244 a.a ) partial recombinant protein expressed in HEK293 cells.