ADIPOQ (Human) Recombinant Protein
  • ADIPOQ (Human) Recombinant Protein

ADIPOQ (Human) Recombinant Protein

Ref: AB-P7342
ADIPOQ (Human) Recombinant Protein

Información del producto

Human ADIPOQ (Q15848, 101 a.a. - 244 a.a ) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 10 ug
Gene Name ADIPOQ
Gene Alias ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 9370

Enviar uma mensagem


ADIPOQ (Human) Recombinant Protein

ADIPOQ (Human) Recombinant Protein