PF4 (Human) Recombinant Protein
  • PF4 (Human) Recombinant Protein

PF4 (Human) Recombinant Protein

Ref: AB-P7328
PF4 (Human) Recombinant Protein

Información del producto

Human PF4 (P02776, 32 a.a. - 101 a.a ) partial recombinant protein expressed in HEK293 cells.
Información adicional
Size 10 ug
Gene Name PF4
Gene Alias CXCL4|MGC138298|SCYB4
Gene Description platelet factor 4
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 5196

Enviar uma mensagem


PF4 (Human) Recombinant Protein

PF4 (Human) Recombinant Protein