Tnf (Rat) Recombinant Protein
  • Tnf (Rat) Recombinant Protein

Tnf (Rat) Recombinant Protein

Ref: AB-P7312
Tnf (Rat) Recombinant Protein

Información del producto

Rat Tnf (P16599, 80 a.a. - 235 a.a.) partial recombinant protein expressed in Pichia pastoris.
Información adicional
Size 10 ug
Gene Name Tnf
Gene Alias MGC124630|RATTNF|TNF-alpha|Tnfa
Gene Description tumor necrosis factor (TNF superfamily, member 2)
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 24835

Enviar uma mensagem


Tnf (Rat) Recombinant Protein

Tnf (Rat) Recombinant Protein