Shh (Mouse) Recombinant Protein
  • Shh (Mouse) Recombinant Protein

Shh (Mouse) Recombinant Protein

Ref: AB-P7307
Shh (Mouse) Recombinant Protein

Información del producto

Mouse Shh (Q62226, 25 a.a. - 198 a.a.) C25IVI mutant partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Shh
Gene Alias 9530036O11Rik|Dsh|Hhg1|Hx|Hxl3|M100081
Gene Description sonic hedgehog
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LVLGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG1VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Gene ID 20423

Enviar uma mensagem


Shh (Mouse) Recombinant Protein

Shh (Mouse) Recombinant Protein