Egf (Mouse) Recombinant Protein
  • Egf (Mouse) Recombinant Protein

Egf (Mouse) Recombinant Protein

Ref: AB-P7299
Egf (Mouse) Recombinant Protein

Información del producto

Mouse Egf (P01132, 977 a.a. - 1029 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Egf
Gene Alias AI790464
Gene Description epidermal growth factor
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Gene ID 13645

Enviar uma mensagem


Egf (Mouse) Recombinant Protein

Egf (Mouse) Recombinant Protein