Cxcl10 (Mouse) Recombinant Protein
  • Cxcl10 (Mouse) Recombinant Protein

Cxcl10 (Mouse) Recombinant Protein

Ref: AB-P7283
Cxcl10 (Mouse) Recombinant Protein

Información del producto

Mouse Cxcl10 (Q548V9, 22 a.a. - 98 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 5 ug
Gene Name Cxcl10
Gene Alias C7|CRG-2|INP10|IP-10|IP10|Ifi10|Scyb10|gIP-10|mob-1
Gene Description chemokine (C-X-C motif) ligand 10
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Gene ID 15945

Enviar uma mensagem


Cxcl10 (Mouse) Recombinant Protein

Cxcl10 (Mouse) Recombinant Protein