View larger
Mouse Cxcl10 (Q548V9, 22 a.a. - 98 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7283
New product
Cxcl10 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | Cxcl10 |
| Gene Alias | C7|CRG-2|INP10|IP-10|IP10|Ifi10|Scyb10|gIP-10|mob-1 |
| Gene Description | chemokine (C-X-C motif) ligand 10 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKA |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
| Gene ID | 15945 |
More info
Mouse Cxcl10 (Q548V9, 22 a.a. - 98 a.a.) partial recombinant protein expressed in Escherichia coli.