View larger
Mouse Ifng (P01580, 23 a.a. - 155 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7261
New product
Ifng (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | Ifng |
| Gene Alias | IFN-g|IFN-gamma|Ifg |
| Gene Description | interferon gamma |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/ml |
| Gene ID | 15978 |
More info
Mouse Ifng (P01580, 23 a.a. - 155 a.a.) partial recombinant protein expressed in Escherichia coli.