Ccl11 (Mouse) Recombinant Protein
  • Ccl11 (Mouse) Recombinant Protein

Ccl11 (Mouse) Recombinant Protein

Ref: AB-P7249
Ccl11 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl11 (P48298, 24 a.a. - 97 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl11
Gene Alias Scya11|eotaxin
Gene Description chemokine (C-C motif) ligand 11
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 20292

Enviar uma mensagem


Ccl11 (Mouse) Recombinant Protein

Ccl11 (Mouse) Recombinant Protein