IFNA1 (Human) Recombinant Protein
  • IFNA1 (Human) Recombinant Protein

IFNA1 (Human) Recombinant Protein

Ref: AB-P7238
IFNA1 (Human) Recombinant Protein

Información del producto

Human IFNA1 (P01562, 24 a.a. - 189 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IFNA1
Gene Alias IFL|IFN|IFN-ALPHA|IFNA13|IFNA@|MGC138207|MGC138505|MGC138507
Gene Description interferon, alpha 1
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN_x005F_x000D__x000D_181LQERLRRKE
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 3439

Enviar uma mensagem


IFNA1 (Human) Recombinant Protein

IFNA1 (Human) Recombinant Protein