IFNA1 (Human) Recombinant Protein View larger

Human IFNA1 (P01562, 24 a.a. - 189 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P7238

New product

IFNA1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name IFNA1
Gene Alias IFL|IFN|IFN-ALPHA|IFNA13|IFNA@|MGC138207|MGC138505|MGC138507
Gene Description interferon, alpha 1
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN_x005F_x000D__x000D_181LQERLRRKE
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 3439

More info

Human IFNA1 (P01562, 24 a.a. - 189 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human IFNA1 (P01562, 24 a.a. - 189 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Human IFNA1 (P01562, 24 a.a. - 189 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.