EREG (Human) Recombinant Protein
  • EREG (Human) Recombinant Protein

EREG (Human) Recombinant Protein

Ref: AB-P7237
EREG (Human) Recombinant Protein

Información del producto

Human EREG (O14944, 60 a.a. - 108 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name EREG
Gene Alias ER
Gene Description epiregulin
Storage Conditions Store at 4C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 2069

Enviar uma mensagem


EREG (Human) Recombinant Protein

EREG (Human) Recombinant Protein